Skip to product information
1 of 1

Cytochrome b5/CYB5A, Human (His)

Cytochrome b5/CYB5A, Human (His)

Size

SKU:QM-0101688-01

£210.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1528 (Gene_ID) P00167 (M1-D134) (Accession)

  • Smiles

    MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

  • Purity

    91.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0101688-01
10 µgQM-0101688-01
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0101688-02
50 µgQM-0101688-02
£520.20/ea
£0.00
£520.20/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Cytochrome b5/CYB5A, Human (His)

Cytochrome b5/CYB5A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.