DC-SIGN/CD209, Human (HEK293, Fc)

Name: DC-SIGN/CD209, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0182589-01
Price: 107.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0182589-01

£107.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, Fc) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-hFc labeled tag.
Molecular Formula
30835 (Gene_ID) Q9NNX6-1 (Q59-A404) (Accession)
Smiles
QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0182589-01	10 µgQM-0182589-01 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0182589-02	50 µgQM-0182589-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

DC-SIGN/CD209, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.