Skip to product information
1 of 1

DCBLD2, Human (HEK293, His)

DCBLD2, Human (HEK293, His)

Size

SKU:QM-0192157-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    131566 (Gene_ID) Q96PD2-1 (Q67-A528) (Accession)

  • Smiles

    QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192157-01
10 µgQM-0192157-01
£76.75/ea
£0.00
£76.75/ea £0.00
50 µgQM-0192157-02
50 µgQM-0192157-02
£216.46/ea
£0.00
£216.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DCBLD2, Human (HEK293, His)

DCBLD2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.