DDX19A, Human (His-SUMO)
DDX19A, Human (His-SUMO)
SKU:QM-0090500
Request quote or documents

Product Details
-
Description
The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
-
Molecular Formula
55308 (Gene_ID) Q9NUU7-1 (M1-N478) (Accession)
-
Smiles
MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
DDX19A, Human (His-SUMO)
DDX19A, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.