Decorin/PGS2, Mouse (HEK293, His)

Name: Decorin/PGS2, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0195067-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0195067-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Decorin/PGS2 protein, influencing fibril formation rate, binds strongly to type I and type II collagen, fibronectin, and TGF-beta. It participates in extracellular matrix organization by forming a ternary complex with MFAP2 and ELN, and interacts with DPT, potentially modulating matrix assembly and structure. Decorin/PGS2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Decorin/PGS2 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
13179 (Gene_ID) P28654 (G17-K354) (Accession)
Smiles
GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0195067-01	5 µgQM-0195067-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0195067-02	10 µgQM-0195067-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0195067-03	50 µgQM-0195067-03 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

100 µgQM-0195067-04	100 µgQM-0195067-04 £331.88/ea	£0.00	Quantity	£331.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Decorin/PGS2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.