Skip to product information
1 of 1

Dectin-1/CLEC7A, Mouse (HEK293, His)

Dectin-1/CLEC7A, Mouse (HEK293, His)

Size

SKU:QM-0076204-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Dectin-1/CLEC7A acts as a lectin and specifically recognizes β-1,3-linked and β-1,6-linked glucans in bacterial and fungal cell walls. Dectin-1/CLEC7A is critical for Toll-like receptor 2 (TLR2) -mediated inflammation by recruiting SYK through its immunoreceptor tyrosine-based activation motif (ITAM), thereby activating NF-kappa-B. Dectin-1/CLEC7A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    56644 (Gene_ID) Q6QLQ4/NP_064392.2 (F69-L244) (Accession)

  • Smiles

    FWRHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0076204-01
5 µgQM-0076204-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0076204-02
10 µgQM-0076204-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0076204-03
50 µgQM-0076204-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0076204-04
100 µgQM-0076204-04
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Dectin-1/CLEC7A, Mouse (HEK293, His)

Dectin-1/CLEC7A, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.