Skip to product information
1 of 1

DEFA3/Defensin alpha 3, Human (HEK293, Fc)

DEFA3/Defensin alpha 3, Human (HEK293, Fc)

Size

SKU:QM-0203542-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The DEFA3/defensin alpha 3 protein is a potent effector in innate immunity against a variety of infectious agents, including bacteria, fungi, and viruses. It neutralizes bacterial toxins, such as Bacillus anthracis lethal factor and Staphylococcus aureus leukocidin, and plays a key role in blocking herpes simplex virus infection by preventing viral attachment. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFA3/Defensin alpha 3 protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    1668 (Gene_ID) P59666 (D39-C94) (Accession)

  • Smiles

    DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203542-01
5 µgQM-0203542-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0203542-02
10 µgQM-0203542-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0203542-03
50 µgQM-0203542-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0203542-04
100 µgQM-0203542-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DEFA3/Defensin alpha 3, Human (HEK293, Fc)

DEFA3/Defensin alpha 3, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.