Skip to product information
1 of 1

DENR, Human (His-SUMO)

DENR, Human (His-SUMO)

Size

SKU:QM-0194578-01

£224.96 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    DENR proteins play a key role in the translation process, participating in mRNA scanning and start codon recognition. It crucially promotes the recruitment of aminoacylated initiator tRNA to the 40S ribosomal P site during translation initiation. DENR Protein, Human (His-SUMO) is the recombinant human-derived DENR protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

  • Molecular Formula

    8562 (Gene_ID) O43583 (A2-K198) (Accession)

  • Smiles

    AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194578-01
5 µgQM-0194578-01
£224.96/ea
£0.00
£224.96/ea £0.00
10 µgQM-0194578-02
10 µgQM-0194578-02
£347.68/ea
£0.00
£347.68/ea £0.00
50 µgQM-0194578-03
50 µgQM-0194578-03
£883.49/ea
£0.00
£883.49/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DENR, Human (His-SUMO)

DENR, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.