Skip to product information
1 of 1

Dermatopontin/DPT, Human (HEK293, Fc, His)

Dermatopontin/DPT, Human (HEK293, Fc, His)

Size

SKU:QM-0173534-01

£188.51 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Dermatopontin/DPT Protein facilitates adhesion by binding to integrins on the cell surface. It acts as a conduit for communication between dermal fibroblast cells and the extracellular matrix. Furthermore, it enhances TGFB1 activity, inhibits cell proliferation, promotes collagen fibril formation, and stabilizes them at low temperatures. DPT Protein interacts with TGFB1, DCN, and collagen. Dermatopontin/DPT Protein, Human (HEK293, Fc, His) is the recombinant human-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

  • Molecular Formula

    1805 (Gene_ID) Q07507 (Q19-V201) (Accession)

  • Smiles

    QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0173534-01
10 µgQM-0173534-01
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0173534-02
50 µgQM-0173534-02
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Dermatopontin/DPT, Human (HEK293, Fc, His)

Dermatopontin/DPT, Human (HEK293, Fc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.