Skip to product information
1 of 1

DERP5, Dermatophagoides pteronyssinus (His)

DERP5, Dermatophagoides pteronyssinus (His)

Size

SKU:QM-0200062-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    DERP5 protein exhibits a monomeric structure and forms homodimeric trimers through concentration-dependent oligomerization, which plays a key role in allergic reactions. Multiple population studies have shown that DERP5 binds to IgE and is associated with mite allergy symptoms such as asthma and rhinitis. DERP5 Protein, Dermatophagoides pteronyssinus (His) is the recombinant DERP5 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    113793750 (Gene_ID) P14004 (M1-V132) (Accession)

  • Smiles

    MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIEV

  • Purity

    95.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200062-01
5 µgQM-0200062-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0200062-02
10 µgQM-0200062-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0200062-03
50 µgQM-0200062-03
£260.19/ea
£0.00
£260.19/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DERP5, Dermatophagoides pteronyssinus (His)

DERP5, Dermatophagoides pteronyssinus (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.