DHH, Human (C23II)

Name: DHH, Human (C23II)
Brand: QuantiMol
SKU: QM-0203727-01
Price: 117.25 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg 500 µg

SKU:QM-0203727-01

£117.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
DHH Protein, Human is a single non-glycosylated polypeptide chain. Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis.
Molecular Formula
50846 (Gene_ID) O43323 (G24-G198, C23II) (Accession)
Smiles
IIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0203727-01	10 µgQM-0203727-01 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0203727-02	50 µgQM-0203727-02 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0203727-03	100 µgQM-0203727-03 £520.20/ea	£0.00	Quantity	£520.20/ea	£0.00

500 µgQM-0203727-04	500 µgQM-0203727-04 £2,042.60/ea	£0.00	Quantity	£2,042.60/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

DHH, Human (C23II) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.