DHH, Human (His-GST, Myc)

Name: DHH, Human (His-GST, Myc)
Brand: QuantiMol
SKU: QM-0204991-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 20 µg 50 µg 100 µg

SKU:QM-0204991-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
DHH Protein, Human (His-GST, Myc) is a single non-glycosylated polypeptide chain. Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis.
Molecular Formula
50846 (Gene_ID) O43323 (G51-K158) (Accession)
Smiles
GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204991-01	5 µgQM-0204991-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0204991-02	10 µgQM-0204991-02 £113.88/ea	£0.00	Quantity	£113.88/ea	£0.00

20 µgQM-0204991-03	20 µgQM-0204991-03 £214.03/ea	£0.00	Quantity	£214.03/ea	£0.00

50 µgQM-0204991-04	50 µgQM-0204991-04 £354.96/ea	£0.00	Quantity	£354.96/ea	£0.00

100 µgQM-0204991-05	100 µgQM-0204991-05 £509.27/ea	£0.00	Quantity	£509.27/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

DHH, Human (His-GST, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.