DHH, Mouse

Name: DHH, Mouse
Brand: QuantiMol
SKU: QM-0202475-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202475-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
DHH Protein, Mouse is a single non-glycosylated polypeptide chain. Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis.
Molecular Formula
13363 (Gene_ID) Q61488 (C23-G198, C23I) (Accession)
Smiles
IGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202475-01	2 µgQM-0202475-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0202475-02	10 µgQM-0202475-02 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

50 µgQM-0202475-03	50 µgQM-0202475-03 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

100 µgQM-0202475-04	100 µgQM-0202475-04 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

DHH, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.