Skip to product information
1 of 1

DKK-1, Human (HEK293, N-His)

DKK-1, Human (HEK293, N-His)

Size

SKU:QM-0180829-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.

  • Molecular Formula

    22943 (Gene_ID) O94907 (T32-H266) (Accession)

  • Smiles

    TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0180829-01
10 µgQM-0180829-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0180829-02
50 µgQM-0180829-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DKK-1, Human (HEK293, N-His)

DKK-1, Human (HEK293, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.