DKK-1, Mouse (CHO)

Name: DKK-1, Mouse (CHO)
Brand: QuantiMol
SKU: QM-0201901-01
Price: 137.5 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0201901-01

£137.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Dkk-1 Protein, Mouse (CHO) is shown to be a potent inhibitor of Wnt signaling and member of dickkopf family.
Molecular Formula
13380 (Gene_ID) O54908 (S30-H272) (Accession)
Smiles
SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQAS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0201901-01	5 µgQM-0201901-01 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

10 µgQM-0201901-02	10 µgQM-0201901-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0201901-03	50 µgQM-0201901-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

DKK-1, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.