DKK-1, Mouse (HEK293, His)

Name: DKK-1, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0204117-01
Price: 79.85 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204117-01

£79.85 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
DKK-1 protein antagonizes canonical Wnt signaling by inhibiting LRP5/6-Wnt interaction and forming a ternary complex with KREMEN, thereby promoting LRP5/6 internalization. In addition to its Wnt-dependent role, DKK1 has Wnt-independent anti-apoptotic activity by inhibiting the pro-apoptotic function of KREMEN1. DKK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DKK1 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
13380 (Gene_ID) O54908 (T32-H272) (Accession)
Smiles
TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204117-01	5 µgQM-0204117-01 £79.85/ea	£0.00	Quantity	£79.85/ea	£0.00

10 µgQM-0204117-02	10 µgQM-0204117-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0204117-03	50 µgQM-0204117-03 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

100 µgQM-0204117-04	100 µgQM-0204117-04 £576.10/ea	£0.00	Quantity	£576.10/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

DKK-1, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.