Skip to product information
1 of 1

DNAM-1, Rat (HEK293, His)

DNAM-1, Rat (HEK293, His)

Size

SKU:QM-0195383-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    307199 (Gene_ID) D3ZS97 (E32-I265) (Accession)

  • Smiles

    EETLWDTTVRLSETMTLECVYPLTDNLTQAEWTKDTGTKKVNIAVYHPNHNMHIDPNYLHRVHFQNATVGFRNMSLSFYNASEADIGIYTCLFHAFPRGSWEKKIKVVQSDSFETTAPLDSYLSAEPGQNVTLSCQLERTWLVQLVIWEKVQPHQVDILASCNLSQGTRYTSKYLRQTWSDCSQESMKSALIIPYAMAADSGLYRCRSEASTGTNKTCVIRLIITDGGTNNHFI

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195383-01
5 µgQM-0195383-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0195383-02
10 µgQM-0195383-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0195383-03
50 µgQM-0195383-03
£238.32/ea
£0.00
£238.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DNAM-1, Rat (HEK293, His)

DNAM-1, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.