Skip to product information
1 of 1

DNase1L3, Mouse (His)

DNase1L3, Mouse (His)

Size

SKU:QM-0181521

£437.58 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    DNase1L3 protein has DNA hydrolytic activity and can effectively cleave single-stranded and double-stranded DNA to generate 3'-OH terminal fragments. It cleaves chromatin into nucleosomal units and participates in internucleosomal DNA fragmentation during apoptosis and necrosis. DNase1L3 Protein, Mouse (His) is the recombinant mouse-derived DNase1L3 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    13421 (Gene_ID) O55070 (L26-S310) (Accession)

  • Smiles

    LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
100 µgQM-0181521
100 µgQM-0181521
£437.58/ea
£0.00
£437.58/ea £0.00

DNase1L3, Mouse (His)

DNase1L3, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.