Skip to product information
1 of 1

Doublecortin/DCX, Human (His)

Doublecortin/DCX, Human (His)

Size

SKU:QM-0077477-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Doublecortin/DCX Protein, a microtubule-associated protein, is vital for early stages of neuronal dispersion and cortex lamination during cerebral cortex development. It may compete with the neuronal protein kinase DCLK1 in binding to a target protein, contributing to crucial signaling pathways involved in neuronal interaction and migration. DCX interacts with tubulin and USP9X. Doublecortin/DCX Protein, Human (His) is the recombinant human-derived Doublecortin/DCX protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    1641 (Gene_ID) O43602-2 (A45-V150) (Accession)

  • Smiles

    ALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNV

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0077477-01
5 µgQM-0077477-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0077477-02
10 µgQM-0077477-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0077477-03
50 µgQM-0077477-03
£260.19/ea
£0.00
£260.19/ea £0.00
100 µgQM-0077477-04
100 µgQM-0077477-04
£409.64/ea
£0.00
£409.64/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Doublecortin/DCX, Human (His)

Doublecortin/DCX, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.