Skip to product information
1 of 1

DPEP1, Human (HEK293, His)

DPEP1, Human (HEK293, His)

Size

SKU:QM-0172857-01

£159.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1800 (Gene_ID) P16444 (D17-S385) (Accession)

  • Smiles

    DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

  • Purity

    97

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172857-01
10 µgQM-0172857-01
£159.13/ea
£0.00
£159.13/ea £0.00
50 µgQM-0172857-02
50 µgQM-0172857-02
£406.69/ea
£0.00
£406.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

DPEP1, Human (HEK293, His)

DPEP1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.