Skip to product information
1 of 1

E-selectin/CD62E, Cynomolgus (HEK293, His)

E-selectin/CD62E, Cynomolgus (HEK293, His)

Size

SKU:QM-0201419-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells. As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    / (Gene_ID) G8F370 (W22-P556) (Accession)

  • Smiles

    WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201419-01
5 µgQM-0201419-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0201419-02
10 µgQM-0201419-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0201419-03
50 µgQM-0201419-03
£243.19/ea
£0.00
£243.19/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

E-selectin/CD62E, Cynomolgus (HEK293, His)

E-selectin/CD62E, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.