Skip to product information
1 of 1

E-Selectin/CD62E, Human (HEK293, His-Fc)

E-Selectin/CD62E, Human (HEK293, His-Fc)

Size

SKU:QM-0169718-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is the recombinant human-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

  • Molecular Formula

    6401 (Gene_ID) P16581 (W22-P556) (Accession)

  • Smiles

    WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169718-01
5 µgQM-0169718-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0169718-02
10 µgQM-0169718-02
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0169718-03
50 µgQM-0169718-03
£193.37/ea
£0.00
£193.37/ea £0.00
100 µgQM-0169718-04
100 µgQM-0169718-04
£293.00/ea
£0.00
£293.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

E-Selectin/CD62E, Human (HEK293, His-Fc)

E-Selectin/CD62E, Human (HEK293, His-Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.