Name: EBAG9, Human (His)
Brand: QuantiMol
SKU: QM-0205830-01
Price: 68.47 GBP
Availability: InStock

Product Details

Description
EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE) -like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
9166 (Gene_ID) O00559-1 (R28-S213) (Accession)
Smiles
RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205830-01	5 µgQM-0205830-01 £68.47/ea	£0.00	Quantity	£68.47/ea	£0.00

10 µgQM-0205830-02	10 µgQM-0205830-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0205830-03	50 µgQM-0205830-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0205830-04	100 µgQM-0205830-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0205830-05	500 µgQM-0205830-05 £1,100.97/ea	£0.00	Quantity	£1,100.97/ea	£0.00

1 mgQM-0205830-06	1 mgQM-0205830-06 £1,732.78/ea	£0.00	Quantity	£1,732.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

EBAG9, Human (His)

EBAG9, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.