Skip to product information
1 of 1

ECH1, Human (His)

ECH1, Human (His)

Size

SKU:QM-0175650-01

£152.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA) -linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1891 (Gene_ID) Q13011 (T34-L328) (Accession)

  • Smiles

    TGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0175650-01
10 µgQM-0175650-01
£152.38/ea
£0.00
£152.38/ea £0.00
50 µgQM-0175650-02
50 µgQM-0175650-02
£417.63/ea
£0.00
£417.63/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ECH1, Human (His)

ECH1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.