ECM1, Rat (HEK293, His)

Name: ECM1, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0204159-01
Price: 99.25 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204159-01

£99.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)
Smiles
ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204159-01	5 µgQM-0204159-01 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

10 µgQM-0204159-02	10 µgQM-0204159-02 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0204159-03	50 µgQM-0204159-03 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

100 µgQM-0204159-04	100 µgQM-0204159-04 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ECM1, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.