Skip to product information
1 of 1

Ecotin, E. coli (His)

Ecotin, E. coli (His)

Size

SKU:QM-0202812-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ecotin, a bacterial protein inhibitor, regulates serine proteases like trypsin and subtilisin. Ecotin's unique surface loop forms a stable complex, influencing enzymatic activity. Ecotin Protein, E. coli (His) is the recombinant E. coli-derived Ecotin protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    946700 (Gene_ID) NP_416713 (A21-R162) (Accession)

  • Smiles

    AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202812-01
5 µgQM-0202812-01
£61.22/ea
£0.00
£61.22/ea £0.00
10 µgQM-0202812-02
10 µgQM-0202812-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0202812-03
50 µgQM-0202812-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0202812-04
100 µgQM-0202812-04
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Ecotin, E. coli (His)

Ecotin, E. coli (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.