Name: EDA2R/XEDAR, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0205468-01
Price: 48.81 GBP
Availability: InStock

Product Details

Description
The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)
Smiles
MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205468-01	2 µgQM-0205468-01 £48.81/ea	£0.00	Quantity	£48.81/ea	£0.00

10 µgQM-0205468-02	10 µgQM-0205468-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0205468-03	50 µgQM-0205468-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0205468-04	100 µgQM-0205468-04 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

500 µgQM-0205468-05	500 µgQM-0205468-05 £1,134.99/ea	£0.00	Quantity	£1,134.99/ea	£0.00

1 mgQM-0205468-06	1 mgQM-0205468-06 £1,655.02/ea	£0.00	Quantity	£1,655.02/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

EDA2R/XEDAR, Mouse (HEK293, His)

EDA2R/XEDAR, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.