EEF1E1, Human (His)

Name: EEF1E1, Human (His)
Brand: QuantiMol
SKU: QM-0184482-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg

SKU:QM-0184482-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
9521 (Gene_ID) O43324 (M1-H174) (Accession)
Smiles
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Purity
95.2
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0184482-01	5 µgQM-0184482-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0184482-02	10 µgQM-0184482-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

EEF1E1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.