Skip to product information
1 of 1

EGF, Canine (His)

EGF, Canine (His)

Size

SKU:QM-0203603-01

£77.78 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (His) is the recombinant canine-derived EGF protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    403657 (Gene_ID) Q9BEA0 (N973-R1024) (Accession)

  • Smiles

    NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203603-01
5 µgQM-0203603-01
£77.78/ea
£0.00
£77.78/ea £0.00
10 µgQM-0203603-02
10 µgQM-0203603-02
£122.88/ea
£0.00
£122.88/ea £0.00
50 µgQM-0203603-03
50 µgQM-0203603-03
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0203603-04
100 µgQM-0203603-04
£492.26/ea
£0.00
£492.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

EGF, Canine (His)

EGF, Canine (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.