Name: EGF, Mouse
Brand: QuantiMol
SKU: QM-0205827-01
Price: 52.94 GBP
Availability: InStock

Product Details

Description
EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.
Molecular Formula
13645 (Gene_ID) P01132 (N977-R1029) (Accession)
Smiles
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205827-01	2 µgQM-0205827-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

5 µgQM-0205827-02	5 µgQM-0205827-02 £65.37/ea	£0.00	Quantity	£65.37/ea	£0.00

10 µgQM-0205827-03	10 µgQM-0205827-03 £73.65/ea	£0.00	Quantity	£73.65/ea	£0.00

20 µgQM-0205827-04	20 µgQM-0205827-04 £88.00/ea	£0.00	Quantity	£88.00/ea	£0.00

50 µgQM-0205827-05	50 µgQM-0205827-05 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

100 µgQM-0205827-06	100 µgQM-0205827-06 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Item added to your cart