Skip to product information
1 of 1

EGF, Mouse (His)

EGF, Mouse (His)

Size

SKU:QM-0187764-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

  • Molecular Formula

    13645 (Gene_ID) P01132 (N977-R1029) (Accession)

  • Smiles

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0187764-01
10 µgQM-0187764-01
£58.12/ea
£0.00
£58.12/ea £0.00
50 µgQM-0187764-02
50 µgQM-0187764-02
£125.13/ea
£0.00
£125.13/ea £0.00
100 µgQM-0187764-03
100 µgQM-0187764-03
£227.39/ea
£0.00
£227.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

EGF, Mouse (His)

EGF, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.