EGF, Mouse (P.pastoris)
EGF, Mouse (P.pastoris)
SKU:QM-0128353
Request quote or documents

Product Details
-
Description
EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (P.pastoris) is the recombinant mouse-derived EGF protein, expressed by P. pastoris , with tag free.
-
Molecular Formula
13645 (Gene_ID) P01132 (N977-R1029) (Accession)
-
Smiles
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
EGF, Mouse (P.pastoris)
EGF, Mouse (P.pastoris) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.