Skip to product information
1 of 1

EGF, Mouse (P.pastoris)

EGF, Mouse (P.pastoris)

Size

SKU:QM-0128353

Price on request
Quantity

Request quote or documents

View full details
  • Description

    EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (P.pastoris) is the recombinant mouse-derived EGF protein, expressed by P. pastoris , with tag free.

  • Molecular Formula

    13645 (Gene_ID) P01132 (N977-R1029) (Accession)

  • Smiles

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0128353
1 EachQM-0128353
£0.00/ea
£0.00
£0.00/ea £0.00

EGF, Mouse (P.pastoris)

EGF, Mouse (P.pastoris) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.