EGF, Rat (CHO)

Name: EGF, Rat (CHO)
Brand: QuantiMol
SKU: QM-0198573-01
Price: 62.26 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0198573-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
EGF Protein, Rat (CHO) is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.
Molecular Formula
25313 (Gene_ID) P07522 (N974-R1026) (Accession)
Smiles
MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0198573-01	10 µgQM-0198573-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

50 µgQM-0198573-02	50 µgQM-0198573-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

100 µgQM-0198573-03	100 µgQM-0198573-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

EGF, Rat (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.