EGF, Rat (Tag Free, Solution)

Name: EGF, Rat (Tag Free, Solution)
Brand: QuantiMol
SKU: QM-0181730-01
Price: 132.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0181730-01

£132.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.
Molecular Formula
25313 (Gene_ID) P07522 (N974-R1026) (Accession)
Smiles
MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Purity
95
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0181730-01	10 µgQM-0181730-01 £132.13/ea	£0.00	Quantity	£132.13/ea	£0.00

50 µgQM-0181730-02	50 µgQM-0181730-02 £230.52/ea	£0.00	Quantity	£230.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

EGF, Rat (Tag Free, Solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.