Skip to product information
1 of 1

EIF1, Human (GST)

EIF1, Human (GST)

Size

SKU:QM-0089853

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The EIF1 protein is a key member of the 43S preinitiation complex (43S PIC), binding to the mRNA cap-proximal region, scanning the 5′-untranslated region, and localizing the initiation codon. EIF1 Protein, Human (GST) is the recombinant human-derived EIF1 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    10209 (Gene_ID) P41567 (M1-F113) (Accession)

  • Smiles

    MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0089853
1 EachQM-0089853
£0.00/ea
£0.00
£0.00/ea £0.00

EIF1, Human (GST)

EIF1, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.