Skip to product information
1 of 1

EIF4EBP2, Human (His)

EIF4EBP2, Human (His)

Size

SKU:QM-0193275-01

£205.52 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1979 (Gene_ID) Q13542 (M1-I120) (Accession)

  • Smiles

    MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0193275-01
10 µgQM-0193275-01
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0193275-02
50 µgQM-0193275-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

EIF4EBP2, Human (His)

EIF4EBP2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.