Skip to product information
1 of 1

EIF5, Human (His-SUMO)

EIF5, Human (His-SUMO)

Size

SKU:QM-0133625

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (His-SUMO) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    1983 (Gene_ID) P55010 (M1-I431) (Accession)

  • Smiles

    MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0133625
1 EachQM-0133625
£0.00/ea
£0.00
£0.00/ea £0.00

EIF5, Human (His-SUMO)

EIF5, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.