ELA-32 (human) (TFA)

ELA-32 (human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM) . ELA-32 (human) TFA exhibits no binding GPR15 and GPR25. ELA-32 (human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32 (human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32 (human) TFA stimulates angiogenesis in HUVEC cells.

C170H289N63O39S4.xC2HF3O2

[QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP(Disulfidebridge:Cys17-Cys22)(TFAsalt)]

Apelin Receptor (APJ)

99.93

DMSO : 100 mg/mL (ultrasonic) |H2O : 100 mg/mL (ultrasonic)

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)

Blue Ice