Skip to product information
1 of 1

ENA-78/CXCL5, Human (HEK293)

ENA-78/CXCL5, Human (HEK293)

Size

SKU:QM-0182923-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CXCL5, also known as neutrophil activating peptide 78 (ENA‐78), is a CXC chemokine containing ELR motif. CXCL5 promotes angiogenesis through interaction with its specific receptor CXCR2. CXCL5 is expressed by many immune cells, such as macrophages, eosinophils, and non-immune cells including mesothelial cells, and fibroblasts.CXCL5/CXCR2 axis not only contributes to the recruitment of neutrophils but also regulates the function of neutrophils in melanoma[1][2]. ENA-78/CXCL5 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 78 amino acids (A37-N114) .

  • Molecular Formula

    6374 (Gene_ID) P42830 (A37-N114) (Accession)

  • Smiles

    AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0182923-01
10 µgQM-0182923-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0182923-02
50 µgQM-0182923-02
£448.52/ea
£0.00
£448.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ENA-78/CXCL5, Human (HEK293)

ENA-78/CXCL5, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.