Skip to product information
1 of 1

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase, E. coli (His)

Size

SKU:QM-0204389-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

  • Molecular Formula

    / (Gene_ID) WP_000506490 (G2-K262) (Accession)

  • Smiles

    GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

  • Purity

    95.2

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204389-01
5 µgQM-0204389-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0204389-02
10 µgQM-0204389-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0204389-03
50 µgQM-0204389-03
£243.19/ea
£0.00
£243.19/ea £0.00
100 µgQM-0204389-04
100 µgQM-0204389-04
£376.83/ea
£0.00
£376.83/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase, E. coli (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.