ENSA, Human (His)

Name: ENSA, Human (His)
Brand: QuantiMol
SKU: QM-0203001-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203001-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
2029 (Gene_ID) O43768-1 (M1-E121) (Accession)
Smiles
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203001-01	5 µgQM-0203001-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203001-02	10 µgQM-0203001-02 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

50 µgQM-0203001-03	50 µgQM-0203001-03 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

100 µgQM-0203001-04	100 µgQM-0203001-04 £266.27/ea	£0.00	Quantity	£266.27/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ENSA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.