EpCAM/TROP1, Mouse (HEK293, Fc)

Name: EpCAM/TROP1, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0172784-01
Price: 75.72 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0172784-01

£75.72 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The EpCAM/TROP1 protein participates in multiple processes, serving as homologous interacting molecules that facilitate communication between mucosal epithelial midgut epithelial cells (IECs) and intraepithelial lymphocytes (IELs) .This helps form an immune barrier against mucosal infections.EpCAM/TROP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
17075 (Gene_ID) Q99JW5 (Q24-T266) (Accession)
Smiles
QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0172784-01	10 µgQM-0172784-01 £75.72/ea	£0.00	Quantity	£75.72/ea	£0.00

50 µgQM-0172784-02	50 µgQM-0172784-02 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

EpCAM/TROP1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.