Ephrin-A2/EFNA2, Rat (HEK293, Fc)

Name: Ephrin-A2/EFNA2, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0169634-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0169634-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Ephrin-A2 (EFNA2) is a member of the ephrin family. Ephrin-A2/EFNA2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
84358 (Gene_ID) F1MA19 (R21-S183) (Accession)
Smiles
RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0169634-01	2 µgQM-0169634-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0169634-02	10 µgQM-0169634-02 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0169634-03	50 µgQM-0169634-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0169634-04	100 µgQM-0169634-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Ephrin-A2/EFNA2, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.