Ephrin-A3/EFNA3, Human (HEK293, His)
Ephrin-A3/EFNA3, Human (HEK293, His)
SKU:QM-0097953
Request quote or documents

Product Details
-
Description
Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
1944 (Gene_ID) P52797-1 (Q23-S211) (Accession)
-
Smiles
QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKS
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Ephrin-A3/EFNA3, Human (HEK293, His)
Ephrin-A3/EFNA3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.