Skip to product information
1 of 1

Ephrin-A3/EFNA3, Human (HEK293, His)

Ephrin-A3/EFNA3, Human (HEK293, His)

Size

SKU:QM-0097953

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1944 (Gene_ID) P52797-1 (Q23-S211) (Accession)

  • Smiles

    QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0097953
1 EachQM-0097953
£0.00/ea
£0.00
£0.00/ea £0.00

Ephrin-A3/EFNA3, Human (HEK293, His)

Ephrin-A3/EFNA3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.