Skip to product information
1 of 1

Ephrin-A3/EFNA3, Mouse (HEK293, Fc)

Ephrin-A3/EFNA3, Mouse (HEK293, Fc)

Size

SKU:QM-0113794-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    13638 (Gene_ID) O08545 (Q23-G206) (Accession)

  • Smiles

    QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISG

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0113794-01
10 µgQM-0113794-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0113794-02
50 µgQM-0113794-02
£327.02/ea
£0.00
£327.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Ephrin-A3/EFNA3, Mouse (HEK293, Fc)

Ephrin-A3/EFNA3, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.