Skip to product information
1 of 1

Ephrin-A4/EFNA4, Human (HEK293, His)

Ephrin-A4/EFNA4, Human (HEK293, His)

Size

SKU:QM-0093290

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Ephrin-A4/EFNA4 Protein, a GPI-bound ligand, interacts with Eph receptors, crucial for neuronal, vascular, and epithelial development. It enables migration, repulsion, and adhesion by binding to neighboring Eph receptors, initiating bidirectional signaling. Furthermore, it potentially facilitates the interaction between activated B-lymphocytes and dendritic cells in tonsils. Ephrin-A4/EFNA4 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1945 (Gene_ID) P52798 (L26-G171) (Accession)

  • Smiles

    LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0093290
1 EachQM-0093290
£0.00/ea
£0.00
£0.00/ea £0.00

Ephrin-A4/EFNA4, Human (HEK293, His)

Ephrin-A4/EFNA4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.