Ephrin-A4/EFNA4, Human (HEK293, His)
Ephrin-A4/EFNA4, Human (HEK293, His)
SKU:QM-0093290
Request quote or documents

Product Details
-
Description
Ephrin-A4/EFNA4 Protein, a GPI-bound ligand, interacts with Eph receptors, crucial for neuronal, vascular, and epithelial development. It enables migration, repulsion, and adhesion by binding to neighboring Eph receptors, initiating bidirectional signaling. Furthermore, it potentially facilitates the interaction between activated B-lymphocytes and dendritic cells in tonsils. Ephrin-A4/EFNA4 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
1945 (Gene_ID) P52798 (L26-G171) (Accession)
-
Smiles
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Ephrin-A4/EFNA4, Human (HEK293, His)
Ephrin-A4/EFNA4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.