1 1

Ephrin-A5/EFNA5, Rhesus Macaque (HEK293, His)

Ephrin-A5/EFNA5, Rhesus Macaque (HEK293, His)

Size

QM-0203271-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    704351 (Gene_ID) F7GZC7 (Q21-N203) (Accession)

  • Smiles

    QDPGSKTVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0203271-01
2 µgQM-0203271-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0203271-02
10 µgQM-0203271-02
£97.00/ea		 £0.00
£97.00/ea £0.00
50 µgQM-0203271-03
50 µgQM-0203271-03
£249.26/ea		 £0.00
£249.26/ea £0.00
100 µgQM-0203271-04
100 µgQM-0203271-04
£370.76/ea		 £0.00
£370.76/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Ephrin-A5/EFNA5, Rhesus Macaque (HEK293, His)

Ephrin-A5/EFNA5, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.