Skip to product information
1 of 1

Ephrin-B1/EFNB1, Human (HEK293, His)

Ephrin-B1/EFNB1, Human (HEK293, His)

Size

SKU:QM-0192557-01

£216.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ephrin-B1/EFNB1 Protein, a transmembrane ligand, interacts with Eph receptors, facilitating bidirectional signaling. It binds EPHB1/ELK and EPHB2/3, inducing axon collapse and growth cone orientation. EFNB1 also interacts with GRIP1/2, TLE1, and enhances ZHX2's transcriptional repression activity. These interactions highlight EFNB1's role in diverse developmental processes. Ephrin-B1/EFNB1 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1947 (Gene_ID) P98172 (L28-G232) (Accession)

  • Smiles

    LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192557-01
10 µgQM-0192557-01
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0192557-02
50 µgQM-0192557-02
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Ephrin-B1/EFNB1, Human (HEK293, His)

Ephrin-B1/EFNB1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.