Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His)

Name: Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His)
Brand: QuantiMol
SKU: QM-0202984-01
Price: 52.94 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202984-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.
Molecular Formula
13641 (Gene_ID) P52795 (K30-S229) (Accession)
Smiles
KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS
Purity
95.28
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202984-01	5 µgQM-0202984-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0202984-02	10 µgQM-0202984-02 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

50 µgQM-0202984-03	50 µgQM-0202984-03 £90.25/ea	£0.00	Quantity	£90.25/ea	£0.00

100 µgQM-0202984-04	100 µgQM-0202984-04 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.