Skip to product information
1 of 1

Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His)

Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His)

Size

SKU:QM-0202984-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

  • Molecular Formula

    13641 (Gene_ID) P52795 (K30-S229) (Accession)

  • Smiles

    KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

  • Purity

    95.28

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202984-01
5 µgQM-0202984-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0202984-02
10 µgQM-0202984-02
£62.26/ea
£0.00
£62.26/ea £0.00
50 µgQM-0202984-03
50 µgQM-0202984-03
£90.25/ea
£0.00
£90.25/ea £0.00
100 µgQM-0202984-04
100 µgQM-0202984-04
£111.63/ea
£0.00
£111.63/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His)

Ephrin-B1/EFNB1, Mouse (HEK293, Fc-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.