Skip to product information
1 of 1

Ephrin-B2/EFNB2, Mouse (HEK293, Fc-His)

Ephrin-B2/EFNB2, Mouse (HEK293, Fc-His)

Size

SKU:QM-0171477-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

  • Molecular Formula

    13642 (Gene_ID) P52800 (R29-E227) (Accession)

  • Smiles

    RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0171477-01
10 µgQM-0171477-01
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0171477-02
50 µgQM-0171477-02
£216.46/ea
£0.00
£216.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Ephrin-B2/EFNB2, Mouse (HEK293, Fc-His)

Ephrin-B2/EFNB2, Mouse (HEK293, Fc-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.